- FAM154B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90520
- Rabbit
- Unconjugated
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: QGLIGETAKL CRPVHTRVTQ NALFEGSTEF RESFQPWEIP PPEVKKVPEY VPPTGSMLLN STSHLDYVPY QANHVVPIR
- FAM154B
- Human
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- stabilizer of axonemal microtubules 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- FAM154B
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
QGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIR
Specifications/Features
Available conjugates: Unconjugated